SFRS11 Recombinant monoclonal antibody Proteintech 83605-6-RR
$299.00
In stock
SKU
83605-6-RR
SRSF11, Splicing factor, arginine/serine-rich 11, Serine/arginine-rich splicing factor 11, p54, Arginine-rich 54 kDa nuclear protein
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag24932 Product name: Recombinant human SFRS11 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 398-483 aa of BC040436 Sequence: KKKSKDKEKDRERKSESDKDVKVTRDYDEEEQGYDSEKEKKEEKKPIETGSPKTKECSVEKGTGDSLRESKVNGDDHHEEDMDMSD Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：SFRS11 | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：SRS11 (Serine/arginine-rich splicing factor 11) may function in pre-mRNA splicing. It is localized in the cell nucleus and can colocalize with spliceosome components. | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
