IL-9 Monoclonal antibody proteintech 66144-1-Ig
$449.00
In stock
SKU
66144-1-Ig
IL9, 1F3A11, IL 9, interleukin 9, interleukin9
| Host / Isotype: Mouse / IgG2b | Class: Monoclonal |
| Reactivity: Human And More (1) | Immunogen: CatNo: Ag21435 Product name: Recombinant human IL-9 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 31-144 aa of BC066284 Sequence: NFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI Predict reactive species |
| Applications: WB, IHC, IF-P, ELISA | Observed Molecular Weight: 144 aa, 16 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC066284 |
| Conjugate: Unconjugated | Gene Symbol: IL9 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 3578 |
| Application: Western Blot (WB) | RRID: AB_2881541 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG2b | Background Information: Interleukin 9 (IL-9) is a γc-family cytokine that is highly produced by T-helper 9 (Th9) cells. IL-9 could promote the survival and activation of various cellular targets, including mast cells, B cells, T cells, and structural cells. Its expression is considered a hallmark of Th2-lineage cells. Primarily studied in Th2-type immunity, IL-9 was shown to be involved in asthma, allergy, and host defense against helminth infections. IL-9 also stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes.(PMID:?38864109; PMID: 29038115; PMID: 9505195; PMID: 29703631) |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
