Neurofibromin Recombinant monoclonal antibody Proteintech 83620-5-RR
$299.00
In stock
SKU
83620-5-RR
NF1, 240540F2, neurofibromin 1, NF 1, NF-1
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag25799 Product name: Recombinant human Neurofibromin protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-100 aa of M60915 Sequence: MAAHRPVEWVQAVVSRFDEQLPIKTGQQNTHTKVSTEHNKECLINISKYKFSLVISGLTTILKNVNNMRIFGEAAEKNLYLSQLIILDTLEKCLAGQPKD Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：Neurofibromin 1 | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：NF1 codes for neurofibromin, a GTPase-activating protein that negatively regulates RAS/MAPK pathway activity by accelerating the hydrolysis of Ras-bound GTP. NF1 has a high mutation rate and mutations in NF1 can alter cellular growth control, and neural development, resulting in neurofibromatosis type 1 (NF1, also known as von Recklinghausen syndrome). | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
