MOSC2 Recombinant monoclonal antibody Proteintech 83705-2-RR
$299.00
In stock
SKU
83705-2-RR
240747G6, EC:1.7.-.-, mARC2, Mitochondrial amidoxime reducing component 2, Moco sulfurase C-terminal domain-containing protein 2
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag20694 Product name: Recombinant human MOSC2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 118-229 aa of BC011973 Sequence: YENNCLIFRAPDMDQLVLPSKQPSSNKLHNCRIFGLDIKGRDCGNEAAKWFTNFLKTEAYRLVQFETNMKGRTSRKLLPTLDQNFQVAYPDYCPLLIMTDASLVDLNTRMEK Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：MOSC2 | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：MOSC domain-containing protein 2 (also known as MOSC2), also known as MARC2, is a component of prodrug-converting system, reduces a multitude of N-hydroxylated prodrugs particularly amidoximes, leading to increased drug bioavailability. Also, MOSC2 may be involved in mitochondrial N(omega)-hydroxy-L-arginine (NOHA) reduction, regulating endogenous nitric oxide levels and biosynthesis. The reductase activity is regulated under adipogenic conditions, and down-regulation of the terminal component MOSC2 resulted in decreased lipid synthesis, suggesting a possible physiological role of this enzyme system and its component MOSC2 in lipogenesis(PMID: 22203676). | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
