FcZero-rAb? APC Anti-Human CXCL9/MIG Rabbit Recombinant Antibody Proteintech APC-FcA98211
$299.00
In stock
SKU
APC-FcA98211
CXCL9, MIG, MIG; CXCL9, 241437F5, CMK
| Formulation::PBS, Azide, BSA | Formulation::PBS, Azide, BSA1 |
| Applications:Flow Cytometry (FC) (INTRA) | Formulation::PBS, Azide, BSA2 |
| Reactivity:Rabbit / IgG | Formulation::PBS, Azide, BSA3 |
| Type:CatNo: Ag17932 Product name: Recombinant human CXCL9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 23-125 aa of BC095396 Sequence: TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT Predict reactive species | Formulation::PBS, Azide, BSA4 |
| RRID:4283 | Formulation::PBS, Azide, BSA5 |
| Storage Buffer:Protein A purification | Formulation::PBS, Azide, BSA6 |
| Background Information:CXCL9 is a small cytokine known as MIG. CXCL9 is a T-cell chemoattractant, which is induced by IFN-γ. It is closely related to two other CXC chemokines called CXCL10 and CXCL11, whose genes are located near the gene for CXCL9 on human chromosome 4. A high level of CXCL9 revealed in peripheral liquids, can be considered as a marker of host immune response, especially of that involving Th1 cells. | Formulation::PBS, Azide, BSA7 |
| biogegep8 | Formulation::PBS, Azide, BSA8 |
| biogegep9 | Formulation::PBS, Azide, BSA9 |
| Formulation::PBS, Azide, BSA0 | Applications:Flow Cytometry (FC) (INTRA)0 |