FNDC5 Polyclonal antibody proteintech 23995-1-AP
$449.00
In stock
SKU
23995-1-AP
Irisin, FRCP2, Fibronectin type III repeat-containing protein 2, Fibronectin type III domain-containing protein 5
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag21195 Product name: Recombinant human FNDC5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 14-76 aa of BC062297 Sequence: SCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLR Predict reactive species |
| Applications: WB, IHC, IF, ELISA | Observed Molecular Weight: 212 aa, 24 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC062297 |
| Conjugate: Unconjugated | Gene Symbol: FNDC5 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 252995 |
| Application: Western Blot (WB) | RRID: AB_2879394 |
| Dilution: WB : 1:1000-1:4000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: fibronectin type III domain containing 5(FNDC5)encodes 23kDa protein, which is a membrane protein that is cleaved and secreted as a newly identified hormone, irisin. The exercise induces muscle FNDC5 expression. Exercise-induced FNDC5 gene expression in muscles was accompanied by a parallel increase in the concentration of circulating irisin, which in turn activates adipocyte thermogenic programs, leading to mitochondrial heat production and energy expenditure. |
Reviews
Write Your Own Review