GARNL1 Recombinant monoclonal antibody Proteintech 82971-1-RR
$299.00
In stock
SKU
82971-1-RR
230165F11, GRIPE, KIAA0884, p240, RALGAPA1
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag31518 Product name: Recombinant human GARNL1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 680-820 aa of NM_014990.3 Sequence: LDLSDLPLDKLSEQKQKKHKGKGVGHEFQKVSVDKSFSRGWSRDQPGQAPMRQRSATTTGSPGTEKARSIVRQKTVDIDDAQILPRSTRVRHFSQSEETGNEVFGALNEEQPLPRSSSTSDILEPFTVERAKVNKEDMSQK Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：GARNL1 | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：GARNL1/RalGAPα1, a major α subunit of the Ral-GTPase activating protein in skeletal muscle, is a protein whose phosphorylation and binding to the regulatory 14-3-3 proteins is stimulated by insulin and also by muscle contraction (PMID:24768767). | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
