EPHB2 Recombinant monoclonal antibody proteintech 83277-1-RR
$449.00
In stock
SKU
83277-1-RR
230111A5, CAPB, Developmentally-regulated Eph-related tyrosine kinase, DRT, EC:2.7.10.1
| Host / Isotype: Rabbit / IgG | Class: Recombinant |
| Reactivity: human | Immunogen: CatNo: Ag28786 Product name: Recombinant human EPHB2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 886-986 aa of BC018763 Sequence: NPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEG Predict reactive species |
| Applications: WB, ELISA | Observed Molecular Weight: 987 aa, 108 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC018763 |
| Conjugate: Unconjugated | Gene Symbol: EPHB2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 2048 |
| Application: Western Blot (WB) | RRID: AB_3670947 |
| Dilution: WB : 1:500-1:1000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Rabbit / IgG |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
