FXYD2 Recombinant monoclonal antibody Proteintech 83860-1-RR

$299.00
In stock
SKU
83860-1-RR

 

240649C2, ATP1C, ATP1G1, FXYD 2, FXYD domain-containing ion transport regulator 2

Formulation::PBS, Azide, Glycerol Formulation::PBS, Azide, Glycerol1
Applications:Western Blot (WB) Formulation::PBS, Azide, Glycerol2
 Reactivity:Rabbit / IgG Formulation::PBS, Azide, Glycerol3
Type:CatNo: Ag34030 Product name: Recombinant human FXYD2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-66 aa of BC013289 Sequence: MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP* Predict reactive species Formulation::PBS, Azide, Glycerol4
RRID:FXYD2 Formulation::PBS, Azide, Glycerol5
Storage Buffer:Liquid Formulation::PBS, Azide, Glycerol6
Background Information:FXYD2 (FXYD domain-containing ion transport regulator 2), also known as the gamma-subunit of the NaK-ATPase, belongs to the FXYD family which has been proposed to be the regulators of Na, K-ATPase function by lowering affinities of the system for potassium and sodium. The expression of FXYD2 is most abundant in kidney, while it is also detected in several other tissues like placenta, pancreas, and dorsal root ganglia (DRGs). Three splice variants of FXYD2 have been reported in mouse kidney, namely FXYD2 γa, -γb,and -γc. FXYD2 γa has been identified as a pancreatic beta cell-specific biomarker. This antibody can recognize all three isoforms of FXYD2. Formulation::PBS, Azide, Glycerol7
biogegep8 Formulation::PBS, Azide, Glycerol8
biogegep9 Formulation::PBS, Azide, Glycerol9
Formulation::PBS, Azide, Glycerol0 Applications:Western Blot (WB)0

 

 

Reviews

Write Your Own Review
You're reviewing:FXYD2 Recombinant monoclonal antibody Proteintech 83860-1-RR
Your Rating
Copyright © 2025 Biogege, Inc. All rights reserved.