FcZero-rAb? Biotin Anti-Human CCL20/MIP-3 alpha Rabbit Recombinant Antibody Proteintech Biotin-FcA98221
$299.00
In stock
SKU
Biotin-FcA98221
CCL20, MIP-3 Alpha, MIP-3α, Beta-chemokine exodus-1, C C motif chemokine 20
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) (INTRA) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg2398 Product name: Recombinant Human CCL20/MIP-3 alpha protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 27-96 aa of NM_004591.3 Sequence: ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：6364 | Formulation:：PBS, Azide5 |
| Storage Buffer：Protein A purification | Formulation:：PBS, Azide6 |
| Background Information：CCL20, also known as macrophage in?ltrating factor protein 3α, is a C-C chemokine that speci?cally binds to the receptor CCR6. CCL20 is produced in various tissues and by a wide range of immune cells, including neutrophils, natural killer cells, T-helper type 17 (Th17) cells, B cells, and various antigen-presenting cells, such as dendritic cells (DCs), Langerhans cells, and macrophages. Increased expression of CCL20 is likely involved in the increased recruitment of dendritic cells observed in fibroinflammatory diseases such as chronic obstructive pulmonary disease (COPD). CCL20 expression is increased by the proinflammatory cytokine IL-1 beta. | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC) (INTRA)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
