EOMES/TBR2 Recombinant monoclonal antibody Proteintech 83945-5-RR
$299.00
In stock
SKU
83945-5-RR
EOMES, TBR2, 241036D9, Eomesodermin homolog, T box brain protein 2
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag27634 Product name: Recombinant human EOMES protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 575-676 aa of NM_001278182 Sequence: MWGGRGSYQRKMAAGLPWTSRTSPTVFSEDQLSKEKVKEEIGSSWIETPPSIKSLDSNDSGVYTSACKRRRLSPSNSSNENSPSIKCEDINAEEYSKDTSKGM Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：EOMES | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：EOMES/TRB2 (also named Eomesodermin/Tbr2) encode T-box transcription factor expressed highly in the intermediate progenitor stage of the developing neuron. During migration of the neurons, radial glia?divide?and migrate towards the surface of the cerebral?cortex, there are three stages of cellular development: radial glia, intermediate progenitors, and postmitotic projection neurons. Radial glia express?Pax6, while intermediate progenitor cells express Eomesodermin/Tbr2, and postmitotic projection neurons express?Tbr1 (PMID:15634788; PMID:16320258). This process also called?neurogenesis, and demonstrated that Eomesodermin/Tbr2 has been implicated in?neurodevelopment. According to the mouse model, several articles showed that EOMES/TRB2 KO mice having proliferating cells decreased and having smaller upper cortical layers and a smaller sub ventricular zone in the brain (PMID:18940588). What's more, Eomesodermin/Tbr2 has also been found participating in immune response (PMID:20713880). | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
