CDK2 Recombinant monoclonal antibody Proteintech 83635-2-RR
$299.00
In stock
SKU
83635-2-RR
EC:2.7.11.22, Cyclin-dependent kinase 2, Cyclin dependent kinase 2, Cell division protein kinase 2, CDKN2
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag17133 Product name: Recombinant human CDK2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 217-298 aa of BC003065 Sequence: RTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：CDK2 | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：CDK2(Cyclin-dependent kinase 2) is also named as CDKN2 and belongs to the protein kinase superfamily,CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily.It is involved in the control of the cell cycle; essential for meiosis, but dispensable for mitosis.It has 2 isoforms produced by alternative splicing. | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
