SLC30A2 Monoclonal antibody proteintech 67993-1-Ig
$449.00
In stock
SKU
67993-1-Ig
FLJ36708, PP12488, SLC30A2, Zinc transporter 2, ZnT 2, ZNT2
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human, Mouse And More (2) | Immunogen: CatNo: Ag8232 Product name: Recombinant human SLC30A2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 234-323 aa of BC006251 Sequence: KGVDFTAVRDLLLSVEGVEALHSLHIWALTVAQPVLSVHIAIAQNTDAQAVLKTASSRLQGKFHFHTVTIQIEDYSEDMKDCQACQGPSD Predict reactive species |
| Applications: WB, IHC, IF, ELISA | Observed Molecular Weight: 323 aa, 35 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC006251 |
| Conjugate: Unconjugated | Gene Symbol: SLC30A2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 7780 |
| Application: Western Blot (WB) | RRID: AB_2918742 |
| Dilution: WB : 1:2000-1:12000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: SLC30A2, also named as the Zn transporter 2 gene (ZnT2), belongs to the cation diffusion facilitator (CDF) transporter (TC 2.A.4) family and SLC30A subfamily. It plays a role in the zinc ion transmembrane transport. Expression of SLC30A2 is restricted to secretory cells, such as acinar pancreatic cells, prostate epithelial cells, placental trophoblasts, Paneth cells, and mammary epithelial cells (MECs). SLC30A2 consists of six transmembrane domains with cytoplasmic N- and C-termini that contain numerous regulatory domains, and functions as a homo- or hetero- dimer to transport Zn into vesicles (PMID: 29476070?). SLC30A2 has 2 isoforms with the molecular mass of 35 and 41 kDa. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
