Biotin Anti-Human CD9 Rabbit scFv Antibody Proteintech Biotin-SF98095
$299.00
In stock
SKU
Biotin-SF98095
5H9, 5H9 antigen, BA2, BTCC 1, CD9 antigen
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / scFv | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg1037 Product name: recombinant human CD9 protein Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 112-195 aa of NM_001769.4 Sequence: SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：928 | Formulation:：PBS, Azide5 |
| Storage Buffer：Affinity purification | Formulation:：PBS, Azide6 |
| Background Information：The cell-surface molecule CD9, a member of the transmembrane-4 superfamily, interacts with the integrin family and other membrane proteins, and is postulated to participate in cell migration and adhesion. Expression of CD9 enhances membrane fusion between muscle cells and promotes viral infection in some cells (PMID:10459022). It is often used as a mesenchymal stem cell marker (PMID:18005405). | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
