AGPAT2 Recombinant monoclonal antibody Proteintech 83349-3-RR
$299.00
In stock
SKU
83349-3-RR
1 AGPAT2, 1-acylglycerol-3-phosphate O-acyltransferase 2, 1-acyl-sn-glycerol-3-phosphate acyltransferase beta, 1-AGP acyltransferase 2, 1-AGPAT 2
| Formulation:：PBS, Azide, Glycerol | Formulation:：PBS, Azide, Glycerol1 |
| Applications：Western Blot (WB) | Formulation:：PBS, Azide, Glycerol2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide, Glycerol3 |
| Type：CatNo: Ag34761 Product name: Recombinant human AGPAT2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 201-279 aa of BC019292 Sequence: VPVVYSSFSSFYNTKKKFFTSGTVTVQVLEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPAQ Predict reactive species | Formulation:：PBS, Azide, Glycerol4 |
| RRID：AGPAT2 | Formulation:：PBS, Azide, Glycerol5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide, Glycerol6 |
| Background Information：1-acyl-sn-glycerol-3-phosphate acyltransferase beta (AGPAT2) belongs to a family of enzymes catalyzing the sn-2 acylation of the glycerol-3-phosphate backbone. AGPAT2 is highly expressed in adipose tissues, liver, and skeletal muscle. AGPAT2 is the only AGPAT isoform whose loss-of-function mutations cause a severe form of human congenital generalized lipodystrophy (PMID: 34824276). Human and mouse AGPAT2 have a calculated molecular mass of 31 kDa, and an alternatively spliced form of AGPAT2 mRNA, encoding a protein of 246 rather than 278 amino acids, is also found in human (PMID: 19336658). Western detected AGPAT2 at an apparent molecular mass of 27 kDa. | Formulation:：PBS, Azide, Glycerol7 |
| biogegep8 | Formulation:：PBS, Azide, Glycerol8 |
| biogegep9 | Formulation:：PBS, Azide, Glycerol9 |
| Formulation:：PBS, Azide, Glycerol0 | Applications：Western Blot (WB)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
