RBX1 Monoclonal antibody proteintech 66716-1-Ig
$449.00
In stock
SKU
66716-1-Ig
Protein ZYP, EC:2.3.2.27, E3 ubiquitin-protein transferase RBX1, E3 ubiquitin-protein ligase RBX1, N-terminally processed, E3 ubiquitin-protein ligase RBX1
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag7005 Product name: Recombinant human RBX1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-108 aa of BC001466 Sequence: MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, CoIP, ELISA | Observed Molecular Weight: 12 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC001466 |
| Conjugate: Unconjugated | Gene Symbol: RBX1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 9978 |
| Application: Western Blot (WB) | RRID: AB_2882067 |
| Dilution: WB : 1:20000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: RBX1(RING-box protein 1) is also named as RNF75, ROC1 and is a requisite component of the multi- subunit SCF family E3s36-40. It mediates the ubiquitination and subsequent proteasomal degradation of target proteins, including proteins involved in cell cycle progression, signal transduction, transcription and transcription-coupled nucleotide excision repair. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
