4EBP1 Recombinant monoclonal antibody Proteintech 83890-5-RR

$299.00
In stock
SKU
83890-5-RR

 

EIF4EBP1, 241055E7, 4E BP1, 4E-BP1, BP 1

Formulation::PBS, Azide, Glycerol Formulation::PBS, Azide, Glycerol1
Applications:Western Blot (WB) Formulation::PBS, Azide, Glycerol2
 Reactivity:Rabbit / IgG Formulation::PBS, Azide, Glycerol3
Type:CatNo: Ag5056 Product name: Recombinant human 4EBP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC004459 Sequence: MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI Predict reactive species Formulation::PBS, Azide, Glycerol4
RRID:EIF4EBP1 Formulation::PBS, Azide, Glycerol5
Storage Buffer:Liquid Formulation::PBS, Azide, Glycerol6
Background Information:4EBP1 (4E-BP1) is a translational regulator and functions by sequestering eukaryotic translation initiation factor 4E (eIF4E) from the translation initiation machinery. 4E-BP1 contains at least six phosphorylation sites (Thr37, Thr46, Ser65, Thr70, Ser83, and Ser112), four of which (Thr37, Thr46, Ser65, and Thr70) are known to be regulated by mTOR signaling. Phosphorylation of Thr37 and Thr46 is thought to prime 4E-BP1 for sequential phosphorylation of Ser65 and Thr70, which results in the dissociation of 4E-BP1 from eIF4E. (PMID: 12747827) Formulation::PBS, Azide, Glycerol7
biogegep8 Formulation::PBS, Azide, Glycerol8
biogegep9 Formulation::PBS, Azide, Glycerol9
Formulation::PBS, Azide, Glycerol0 Applications:Western Blot (WB)0

 

 

Reviews

Write Your Own Review
You're reviewing:4EBP1 Recombinant monoclonal antibody Proteintech 83890-5-RR
Your Rating
Copyright © 2025 Biogege, Inc. All rights reserved.