Angiopoietin 1 Monoclonal antibody proteintech 68618-1-Ig
$449.00
In stock
SKU
68618-1-Ig
ANGPT1, ANG-1, ANG1, ANG 1, AGPT
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, mouse | Immunogen: CatNo: Ag18829 Product name: Recombinant human ANGPT1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 161-293 aa of BC152411 Sequence: IQLLENSLSTYKLEKQLLQQTNEILKIHEKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVTRQTYIIQELEKQLNRATTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAG Predict reactive species |
| Applications: WB, IF/ICC, ELISA | Observed Molecular Weight: 498 aa, 58 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC152411 |
| Conjugate: Unconjugated | Gene Symbol: Angiopoietin 1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 284 |
| Application: Western Blot (WB) | RRID: AB_3085311 |
| Dilution: WB : 1:2000-1:10000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: Angiopoietin 1 is a 70-kDa secreted glycoprotein generated from vascular mural cells, pericytes, and certain other cells. Angiopoietin 1 participates in vascular differentiation through angiogenesis, which is the process of the growth and remodelling of existing vessels. Angiopoietin 1 is also involved in the maintenance and turnover of blood vessels in mature animals. Angiopoietin 1 binds to and activates the TEK/TIE2 receptor by inducing its dimerization and tyrosine phosphorylation, playing an important role in the regulation of angiogenesis. Overexpression of Angiopoietin 1 has been proven to occur in malignant glioblastoma, neuroblastoma, non-small cell lung cancer, and other tumors. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
