Anti-Human CXCL8/IL-8 Rabbit Recombinant Antibody Proteintech 98137-1-RR
$299.00
In stock
SKU
98137-1-RR
CXCL8, IL8, IL-8, 240889B2, C X C motif chemokine 8
| Formulation:：PBS, Azide | Formulation:：PBS, Azide1 |
| Applications：Flow Cytometry (FC) (INTRA) | Formulation:：PBS, Azide2 |
| Reactivity：Rabbit / IgG | Formulation:：PBS, Azide3 |
| Type：CatNo: Eg0152 Product name: Recombinant Human CXCL8/IL-8 protein (Myc Tag, His Tag) Source: mammalian cells-derived, pHZ-KIsec Tag: Myc & 6*His Domain: 28-99 aa of BC013615 Sequence: SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS Predict reactive species | Formulation:：PBS, Azide4 |
| RRID：3576 | Formulation:：PBS, Azide5 |
| Storage Buffer：Liquid | Formulation:：PBS, Azide6 |
| Background Information：Interleukin 8 (IL-8), also known as CXCL8, is a CXC chemokine family member. This chemokine is secreted by a variety of cell types including monocyte/macrophages, T cells, neutrophils, fibroblasts, endothelial cells, and various tumor cell lines in response to inflammatory stimuli. IL-8 has two primary functions. It induces chemotaxis in target cells, primarily neutrophils but also other granulocytes, causing them to migrate toward the site of infection. IL-8 also induces phagocytosis once they have arrived. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. IL-8 is also known to be a potent promoter of angiogenesis. IL-8 has been associated with tumor angiogenesis, metastasis, and poor prognosis in breast cancer. IL-8 may present a novel therapeutic target for estrogen driven breast carcinogenesis and tumor progression. | Formulation:：PBS, Azide7 |
| biogegep8 | Formulation:：PBS, Azide8 |
| biogegep9 | Formulation:：PBS, Azide9 |
| Formulation:：PBS, Azide0 | Applications：Flow Cytometry (FC) (INTRA)0 |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
