SUMO1 Polyclonal antibody proteintech 10329-1-AP
$449.00
In stock
SKU
10329-1-AP
GAP-modifying protein 1, GMP1, OK/SW-cl.43, Sentrin, Small ubiquitin related modifier 1
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag0414 Product name: Recombinant human SUMO1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC006462 Sequence: MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV Predict reactive species |
| Applications: WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA | Observed Molecular Weight: 12 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC006462 |
| Conjugate: Unconjugated | Gene Symbol: SUMO1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 7341 |
| Application: Western Blot (WB) | RRID: AB_2286872 |
| Dilution: WB : 1:1000-1:4000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
