IFIT1 Polyclonal antibody proteintech 23247-1-AP
$449.00
In stock
SKU
23247-1-AP
G10P1, IFI 56K, IFI56, IFI-56K, IFIT 1
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag19691 Product name: Recombinant human IFIT1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 340-460 aa of BC007091 Sequence: EVAHLDLARMYIEAGNHRKAEENFQKLLCMKPVVEETMQDIHFHYGRFQEFQKKSDVNAIIHYLKAIKIEQASLTRDKSINSLKKLVLRKLRRKALDLESLSLLGFVYKLEGNMNEALEYY Predict reactive species |
| Applications: WB, IHC, IF/ICC, CoIP, ELISA | Observed Molecular Weight: 478 aa, 55 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC007091 |
| Conjugate: Unconjugated | Gene Symbol: IFIT1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 3434 |
| Application: Western Blot (WB) | RRID: AB_2811269 |
| Dilution: WB : 1:1000-1:4000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: IFIT1, also known as glucocorticoid-attenuated response gene 16 protein (GARG-16), is a 463 amino acid protein belonging to the IFIT family. IFIT genes comprise a large family with three (IFIT1, IFIT2, and IFIT3) and four (IFIT1, IFIT2, IFIT3, and IFIT5) members in mice and humans, respectively. IFIT1 specifically bound virus PPP-RNA forms a complex with IFIT2 and IFIT3 to sequester the viral PPP-RNA and prevent virus replication. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
