MITF Polyclonal antibody proteintech 13092-1-AP

$449.00
In stock
SKU
13092-1-AP

 

bHLHe32, Class E basic helix-loop-helix protein 32, MI, Microphthalmia-associated transcription factor, WS2A

Host / Isotype: Rabbit / IgG Class: Polyclonal
Reactivity: human, mouse, rat Immunogen: CatNo: Ag3679 Product name: Recombinant human MITF protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC012503 Sequence: MLEMLEYNHYQVQTHLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMPPVPGSSAPNSPMAMLTLNSNCEKEFMKQ Predict reactive species
 Applications: WB, IHC, IF, FC (Intra), IP, ELISA Observed Molecular Weight: 91 aa, 10 kDa, 59 kDa
Formulation: PBS, Azide, Glycerol GenBank Accession Number: BC012503
Conjugate: Unconjugated Gene Symbol: MITF
Tested Applications: Positive WB detected in Gene ID (NCBI): 4286
Application: Western Blot (WB) RRID: AB_10597698
Dilution: WB : 1:500-1:3000 Conjugate: Unconjugated
Tested Reactivity: Human, Mouse, Rat Form: Liquid
Host / Isotype: Rabbit / IgG Background Information: The retinal pigment epithelium (RPE) has a essential role in maintaining visual function and dedifferentiation of RPE contributes to the pathophysiology of several ocular diseases[PMID: 22523078]. Microphthalmia-associated transcription factor (MITF) is a key regulator of RPE differentiation that is also down-regulated in dedifferentiated hfRPE cells. MITF is a basic helix-loop-helix (hHLH)-leucine zipper protein that involves in the development of various cell types, including neural crest-derived melanocytes and optic cup-derived retinal pigment epithelial cells [PMID: 10578055].

 

 

Reviews

Write Your Own Review
You're reviewing:MITF Polyclonal antibody proteintech 13092-1-AP
Your Rating
Copyright © 2025 Biogege, Inc. All rights reserved.