MITF Polyclonal antibody proteintech 13092-1-AP
$449.00
In stock
SKU
13092-1-AP
bHLHe32, Class E basic helix-loop-helix protein 32, MI, Microphthalmia-associated transcription factor, WS2A
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag3679 Product name: Recombinant human MITF protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC012503 Sequence: MLEMLEYNHYQVQTHLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMPPVPGSSAPNSPMAMLTLNSNCEKEFMKQ Predict reactive species |
| Applications: WB, IHC, IF, FC (Intra), IP, ELISA | Observed Molecular Weight: 91 aa, 10 kDa, 59 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC012503 |
| Conjugate: Unconjugated | Gene Symbol: MITF |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 4286 |
| Application: Western Blot (WB) | RRID: AB_10597698 |
| Dilution: WB : 1:500-1:3000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: The retinal pigment epithelium (RPE) has a essential role in maintaining visual function and dedifferentiation of RPE contributes to the pathophysiology of several ocular diseases[PMID: 22523078]. Microphthalmia-associated transcription factor (MITF) is a key regulator of RPE differentiation that is also down-regulated in dedifferentiated hfRPE cells. MITF is a basic helix-loop-helix (hHLH)-leucine zipper protein that involves in the development of various cell types, including neural crest-derived melanocytes and optic cup-derived retinal pigment epithelial cells [PMID: 10578055]. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
