WNT1 Polyclonal antibody proteintech 27935-1-AP
$449.00
In stock
SKU
27935-1-AP
INT1, Proto oncogene Int 1 homolog, Proto oncogene Wnt 1, Proto-oncogene Int-1 homolog, Proto-oncogene Wnt-1
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse And More (1) | Immunogen: CatNo: Ag27380 Product name: Recombinant human WNT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 228-323 aa of BC074799 Sequence: TVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALD Predict reactive species |
| Applications: WB, IHC, IF/ICC, FC (Intra), ELISA | Observed Molecular Weight: 41 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: WNT1 |
| Conjugate: Unconjugated | Gene Symbol: 7471 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): AB_2881013 |
| Application: Western Blot (WB) | RRID: Unconjugated |
| Dilution: WB : 1:500-1:2000 | Conjugate: Liquid |
| Tested Reactivity: Human, Mouse | Form: Antigen affinity purification |
| Host / Isotype: Rabbit / IgG |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
