HMGA2 Polyclonal antibody proteintech 20795-1-AP
$449.00
In stock
SKU
20795-1-AP
BABL, high mobility group AT hook 2, HMGA2, HMGI C, HMGIC, LIPO, STQTL9
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag14588 Product name: Recombinant human HMGA2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-109 aa of NM_003483 Sequence: MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEATGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, CoIP, ELISA | Observed Molecular Weight: 108 aa, 12 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: NM_003483 |
| Conjugate: Unconjugated | Gene Symbol: HMGA2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 8091 |
| Application: Western Blot (WB) | RRID: AB_2665377 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: human, mouse, rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: HMGA2 belongs to the family of high mobility group with AT-hook DNA binding domain. HMGA proteins are considered architectural transcription factors; they do not have direct transcriptional activation capacity, but instead regulate gene expression by changing DNA conformation through binding to AT-rich regions in the DNA and/or direct interaction with other transcription factors (PMID: 18202751,19551524). HMGA2 is abundantly and ubiquitously expressed and plays a crucial role during embryonic development (18425117). HMGA2 promotes stem cell self-renewal and research studies have shown that decreased HMGA2 expression is associated with stem cell aging (19551524). Investigators have shown that expression levels of HMGA2 are very low in normal adult tissues, while either overexpression or rearrangement is associated with many types of cancer (PMID: 20228781). The calcualted molecular weight of HMGA2 is 12 kDa, but modified HMGA2 is about 18-20 kDa. (PMID: 18505920 ) |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
