Claudin 1 Polyclonal antibody proteintech 28674-1-AP
$449.00
In stock
SKU
28674-1-AP
Caudin 1, CLDN1, Claudin-1, CLD1, ILVASC
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (5) | Immunogen: CatNo: Ag29269 Product name: Recombinant human Claudin 1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 102-211 aa of BC012471 Sequence: MKCMKCLEDDEVQKMRMAVIGGAIFLLAGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 211 aa, 23 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC012471 |
| Conjugate: Unconjugated | Gene Symbol: Claudin 1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 9076 |
| Application: Western Blot (WB) | RRID: AB_2881190 |
| Dilution: WB : 1:1000-1:6000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Claudins are a family of proteins that are the most important components of tight junctions, where they establish the paracellular barrier that controls the flow of molecules in the intercellular space between the cells of an epithelium. 23 claudins have been identified. They are small (20-27 kilodalton (kDa)) proteins with similar structures. They have four transmembrane domains, with the N-terminus and the C-terminus in the cytoplasm. Claudin-1 is an integral membrane protein expressed primarily in keratinocytes and normal mammary epithelial cells. Claudin 1 forms tight junctions with other claudin proteins and plays an important role in the intestinal epithelial barrier. |
Reviews
Write Your Own Review