VWF Polyclonal antibody proteintech 27186-1-AP
$449.00
In stock
SKU
27186-1-AP
VWF, VWFpp, F8VWF, von Willebrand antigen II, VWD
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag25578 Product name: Recombinant human vwf protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 754-854 aa of Sequence: MSSPLSHRSKRSLSCRPPMVKLVCPADNLRAEGLECTKTCQNYDLECMSMGCVSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGETVKIGCNTCVCQD Predict reactive species |
| Applications: WB, IHC, IF-P, ELISA | Observed Molecular Weight: 220-250 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: 7450 |
| Conjugate: Unconjugated | Gene Symbol: AB_2880791 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): Unconjugated |
| Application: Western Blot (WB) | RRID: Liquid |
| Dilution: WB : 1:500-1:1000 | Conjugate: Antigen affinity purification |
| Tested Reactivity: Human, Mouse, Rat | Form: P04275 |
| Host / Isotype: Rabbit / IgG |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
