TFF2 Polyclonal antibody proteintech 13681-1-AP
$449.00
In stock
SKU
13681-1-AP
SML1, trefoil factor 2, Spasmolytic polypeptide, Spasmolysin, SP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse And More (2) | Immunogen: CatNo: Ag4537 Product name: Recombinant human TFF2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-129 aa of BC032820 Sequence: MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY Predict reactive species |
| Applications: WB, IHC, IF-P, IP, ELISA | Observed Molecular Weight: 129 aa, 14 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC032820 |
| Conjugate: Unconjugated | Gene Symbol: TFF2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 7032 |
| Application: Western Blot (WB) | RRID: AB_10598321 |
| Dilution: WB : 1:200-1:1000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: The trefoil factor family (TFF), comprises of three polypeptides, TFF1, TFF2 and TFF3 (7-12 kDa), secreted to mucosal surfaces by mucus producing cells, prominently in the gastrointestinal tract. TFF2, also known as spasmolytic polypeptide, is a low-molecular weight protein, expressed in mucous neck cells of the fundus and glands at the base of the antrum in normal human stomach. TFF2 could Inhibit gastrointestinal motility and gastric acid secretion. However, recent studies suggest that TFF2 could also play an important role in the immune system. We got a 18-20 kDa band in western botting maybe due to glycosylatation, and mature TFF2 is a 12 kDa protein (PMID: 10716671). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
