FABP5 Polyclonal antibody proteintech 12348-1-AP
$449.00
In stock
SKU
12348-1-AP
EFABP, Epidermal-type fatty acid-binding protein, Fatty acid binding protein 5, Fatty acid-binding protein 5, Fatty acid-binding protein, epidermal
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (1) | Immunogen: CatNo: Ag3005 Product name: Recombinant human FABP5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-135 aa of BC019385 Sequence: MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE Predict reactive species |
| Applications: WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA | Observed Molecular Weight: 135 aa, 15 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC019385 |
| Conjugate: Unconjugated | Gene Symbol: FABP5 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 2171 |
| Application: Western Blot (WB) | RRID: AB_2100341 |
| Dilution: WB : 1:1000-1:6000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: FABP5, also named as PA-FABP and E-FABP, belongs to the calycin superfamily and Fatty-acid binding protein (FABP) family. It is high specificity for fatty acids. FABP5 is highest affinity for C18 chain length. It may be involved in keratinocyte differentiation. FABP5 is a fatty acid-binding protein and is expressed in epidermis and endothelial cells of the microvasculature of different organs. FABP5 has also been identified as a tumor-associated antigen, which is highly expressed in various cancers. FABP5 was detected in the sera of HNSCC patients with early stage cancer. Antibodies specific for FABP5 were significantly increased in a substantial amount in patients, suggesting that FABP5 may be a potential diagnostic biomarker for HNSCC. FABP5 may serve as a biomarker for HNSCC.(PMID:19602232) |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
