CISD1 Polyclonal antibody proteintech 16006-1-AP
$449.00
In stock
SKU
16006-1-AP
C10orf70, CDGSH iron sulfur domain 1, CDGSH iron-sulfur domain-containing protein 1, Cysteine transaminase CISD1, EC:2.6.1.3
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (1) | Immunogen: CatNo: Ag8680 Product name: Recombinant human mitoNEET,CISD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-108 aa of BC007043 Sequence: MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET Predict reactive species |
| Applications: WB, IHC, IF/ICC, IP, ELISA | Observed Molecular Weight: 108 aa, 12 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC007043 |
| Conjugate: Unconjugated | Gene Symbol: CISD1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 55847 |
| Application: Western Blot (WB) | RRID: AB_2080268 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: MitoNEET, also named CISD1, belongs to a previously uncharacterized ancient family of proteins for which the hallmark is the presence of a unique 39 amino acid CDGSH domain. It is a single-pass type III membrane protein, located in mitochondrion outer membrane and may play a role in regulating maximal capacity for electron transport and oxidative phosphorylation. MitoNEET is a recently identified drug target for a commonly prescribed diabetes drug, Pioglitazone. This antibody recognizing MitoNEET (calculated 12 kDa) as a 17 kDa protein may be due to its posttranslational modification or metal binding activity. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
