MCT4 Polyclonal antibody proteintech 22787-1-AP
$449.00
In stock
SKU
22787-1-AP
MCT-4, SLC16A3, MCT 4, MCT3
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (1) | Immunogen: CatNo: Ag18788 Product name: Recombinant human SLC16A3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 402-465 aa of BC112269 Sequence: LLLGNFFCIRKKPKEPQPEVAAAEEEKLHKPPADSGVDLREVEHFLKAEPEKNGEVVHTPETSV Predict reactive species |
| Applications: WB, IHC, IF/ICC, FC (Intra), IP, ELISA | Observed Molecular Weight: 465 aa, 49 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC112269 |
| Conjugate: Unconjugated | Gene Symbol: MCT4 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 9123 |
| Application: Western Blot (WB) | RRID: AB_11182479 |
| Dilution: WB : 1:2000-1:20000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: The monocarboxylate transporter 4 (MCT4, also known as SLC16A3) is involved in the transportation of metabolically important monocarboxylates such as?lactate, pyruvate, acetate and ketone bodies. It is widely expressed, particularly strongly in glycolytic tissues such as white skeletal muscle fibres, astrocytes, white blood cells, chondrocytes and some mammalian cell lines. MCT4 is also linked to tumor biology because it mediates lactate transport across membranes resulting in antiapoptotic effects. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
