CD86 (C-terminal) Polyclonal antibody proteintech 26903-1-AP
$449.00
In stock
SKU
26903-1-AP
CD86, Activation B7 2 antigen, Activation B7-2 antigen, B7 2, B70
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human | Immunogen: CatNo: Ag25432 Product name: Recombinant human CD86 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 270-329 aa of BC040261 Sequence: WKKKKRPRNSYKCGTNTMEREESEQTKKREKIHIPERSDETQRVFKSSKTSSCDKSDTCF Predict reactive species |
| Applications: WB, IHC, IF-P, ELISA | Observed Molecular Weight: 329 aa, 38 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC040261 |
| Conjugate: Unconjugated | Gene Symbol: CD86 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 942 |
| Application: Western Blot (WB) | RRID: ENSG00000114013 |
| Dilution: WB : 1:500-1:3000 | Conjugate: AB_2880677 |
| Tested Reactivity: Human | Form: Unconjugated |
| Host / Isotype: Rabbit / IgG | Background Information: CD86 (also known as B7.2) is a costimulatory molecule belonging to the immunoglobulin superfamily. Primarily expressed on antigen-presenting cells (APCs), including B cells, dendritic cells, and macrophages, CD86 is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4. Binding of CD86 with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of CD86 with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
