Integrin Beta 1/CD29 Polyclonal antibody proteintech 26918-1-AP
$449.00
In stock
SKU
26918-1-AP
ITGB1, CD29, FNRB, Glycoprotein IIa, GPIIA
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: Human, Mouse, Rat And More (1) | Immunogen: CatNo: Ag25426 Product name: Recombinant human Integrin beta-1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 752-798 aa of BC020057 Sequence: KLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK Predict reactive species |
| Applications: WB, IHC, ELISA | Observed Molecular Weight: 88 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC020057 |
| Conjugate: Unconjugated | Gene Symbol: Integrin beta 1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 3688 |
| Application: Western Blot (WB) | RRID: ENSG00000150093 |
| Dilution: WB : 1:500-1:2000 | Conjugate: AB_2880685 |
| Tested Reactivity: Human, Mouse, Rat | Form: Unconjugated |
| Host / Isotype: Rabbit / IgG |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
