VGLUT2 Polyclonal antibody proteintech 29209-1-AP
$449.00
In stock
SKU
29209-1-AP
SLC17A6, Differentiation-associated BNPI, Differentiation-associated Na(+)-dependent inorganic phosphate cotransporter, DNPI
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse | Immunogen: CatNo: Ag29565 Product name: Recombinant human SLC17A6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 499-582 aa of NM_020346 Sequence: SGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATTQANGGWPSGWEKKEEFVQGEVQDSHSYKDRVDYS Predict reactive species |
| Applications: WB, IHC, IF-P, IF-Fro, ELISA | Observed Molecular Weight: 64 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: NM_020346 |
| Conjugate: Unconjugated | Gene Symbol: VGLUT2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 57084 |
| Application: Western Blot (WB) | RRID: AB_3086104 |
| Dilution: WB : 1:500-1:3000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: VGLUT2, also known as SLC17A6, belongs to the major facilitator superfamily. VGLUT2 is a multifunctional transporter that transports phosphate at the plasma membrane and glutamate in synaptic vesicles (PMID:33440152, 11432869). VGLUT2 is involved in neurotransmitter loading into synaptic vesicles (PMID: 11698620). VGLUT2 is predominantly expressed in adult and fetal brain, with highest expression in the medulla, substantia nigra, subthalamic nucleus, and thalamus, and low levels in the cerebellum and hippocampus (PMID:10820226). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
