WTAP Polyclonal antibody proteintech 10200-1-AP
$449.00
In stock
SKU
10200-1-AP
Wilms tumor 1-associating protein, Pre-mRNA-splicing regulator WTAP, Mum2, KIAA0105, FL2D
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag0259 Product name: Recombinant human WTAP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 2-150 aa of BC000383 Sequence: TNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQNELSAWKFTPD Predict reactive species |
| Applications: WB, IHC, IF, IP, CoIP, RIP, ELISA | Observed Molecular Weight: 45 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC000383 |
| Conjugate: Unconjugated | Gene Symbol: WTAP |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 9589 |
| Application: Western Blot (WB) | RRID: AB_2216349 |
| Dilution: WB : 1:2000-1:16000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: WTAP, also named as KIAA0105 and hFL(2)D, is previously identified as a protein associated with Wilms' tumor-1 (WT-1) protein that is essential for the development of the genitourinary system. It is a Pre-mRNA-splicing regulator protein. It is a regulatory subunit of the WMM N6-methyltransferase complex which plays a role in the efficiency of mRNA splicing and processing and mRNA stability. It is required for accumulation of METTL3 and METTL14 to nuclear speckle. MW of WTAP is 50-55 kDa due to phosphorylation. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
