TFPI2 Recombinant monoclonal antibody proteintech 83279-1-RR
$449.00
In stock
SKU
83279-1-RR
TFPI 2, REF1, PP5, Placental protein 5, 230135E3
| Host / Isotype: Rabbit / IgG | Class: Recombinant |
| Reactivity: Human And More (1) | Immunogen: CatNo: Ag33467 Product name: Recombinant human TFPI2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 71-190 aa of NM_001271003.1 Sequence: GNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTG Predict reactive species |
| Applications: WB, ELISA | Observed Molecular Weight: 27 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: NM_001271003.1 |
| Conjugate: Unconjugated | Gene Symbol: TFPI2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 7980 |
| Application: Western Blot (WB) | RRID: AB_3670948 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: TFPI2 (tissue factor pathway inhibitor 2), also known as PP5. It is expected to be located in extracellular space, and the protein is enriched in the placenta. This gene encodes a member of the Kunitz-type serine proteinase inhibitor family. The protein can inhibit a variety of serine proteases including factor VIIa/tissue factor, factor Xa, plasmin, trypsin, chymotrypsin and plasma kallikrein. This gene has been identified as a tumor suppressor gene in several types of cancer. The molecular weight of TFPI2 is 27 kDa, and it can recognize the band of 36 kDa (PMID: 21421890). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
