SIAH1 Recombinant monoclonal antibody proteintech 83389-4-RR
$449.00
In stock
SKU
83389-4-RR
240377B4, E3 ubiquitin-protein ligase SIAH1, EC:2.3.2.27, RING-type E3 ubiquitin transferase SIAH1, Siah-1
| Host / Isotype: Rabbit / IgG | Class: Recombinant |
| Reactivity: human, mouse | Immunogen: CatNo: Ag34618 Product name: Recombinant human SIAH1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC035562 Sequence: MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLP Predict reactive species |
| Applications: WB, IHC, ELISA | Observed Molecular Weight: 282 aa, 31 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC035562 |
| Conjugate: Unconjugated | Gene Symbol: SIAH1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 6477 |
| Application: Western Blot (WB) | RRID: AB_3671043 |
| Dilution: WB : 1:2000-1:10000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: SIAH1, also named as HUMSIAH, Siah-1a and Siah-1S(21kd), belongs to the SINA (Seven in absentia) family. SIAH1 is known to cause indirect degradation of beta-catenin through formation of a complex with Siah-interacting protein (SIP), Skp1 and Ebi. SIAH1 can form heterodimer or homodimer such as Siah-1*Siah-1(70 or 62kd), Siah-1*Siah-1S(42kd) and Siah-1S*Siah-1S(51-56kd). Importantly, results from in vitro soft agar assay demonstrated that Siah-1S displays a promotion effect on cells tumorigenicity. (PMID:17420721) |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
