Anti-Rat CD90 Rabbit Recombinant Antibody proteintech 98162-1-RR
$74.00
In stock
SKU
98162-1-RR
241388F3, Thy1, Thy-1, Thy-1 antigen, Thy-1 membrane glycoprotein
| Host / Isotype: Rabbit / IgG | Class: Recombinant |
| Reactivity: rat | Immunogen: CatNo: Eg1463 Product name: Recombinant Rat CD90/Thy1 protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 20-130 aa of NM_012673.2 Sequence: QRVISLTACLVNQNLRLDCRHENNTNLPIQHEFSLTREKKKHVLSGTLGVPEHTYRSRVNLFSDRFIKVLTLANFTTKDEGDYMCELRVSGQNPTSSNKTINVIRDKLVKC Predict reactive species |
| Applications: FC | Observed Molecular Weight: 18 kDa |
| Formulation: PBS, Azide | GenBank Accession Number: Thy1 |
| Conjugate: Unconjugated | Gene Symbol: 24832 |
| Tested Applications: Positive FC detected in | Gene ID (NCBI): AB_3672305 |
| Application: Flow Cytometry (FC) | RRID: Unconjugated |
| Dilution: FC : 0.25 ug per 10^6 cells in 100 μl suspension | Conjugate: Liquid |
| Tested Reactivity: Rat | Form: Protein A purfication |
| Host / Isotype: Rabbit / IgG | Background Information: CD90 (Thy-1) is a 25 kDa, GPI-linked membrane glycoprotein that belongs to immunoglobulin superfamily (PMID: 6177036; 6153212). Originally described as a brain thymus cross-reactive antigen, it is found in large quantities on mouse and rat thymocytes and central nervous system cells (PMID: 83175). CD90 has been postulated to be involved in cellular recognition, adherence, and T cell activation (PMID: 7683034). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
