Anti-Rat CD90 Rabbit Recombinant Antibody proteintech 98162-1-RR

$74.00
In stock
SKU
98162-1-RR

 

241388F3, Thy1, Thy-1, Thy-1 antigen, Thy-1 membrane glycoprotein

Host / Isotype: Rabbit / IgG Class: Recombinant
Reactivity: rat Immunogen: CatNo: Eg1463 Product name: Recombinant Rat CD90/Thy1 protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 20-130 aa of NM_012673.2 Sequence: QRVISLTACLVNQNLRLDCRHENNTNLPIQHEFSLTREKKKHVLSGTLGVPEHTYRSRVNLFSDRFIKVLTLANFTTKDEGDYMCELRVSGQNPTSSNKTINVIRDKLVKC Predict reactive species
 Applications: FC Observed Molecular Weight: 18 kDa
Formulation: PBS, Azide GenBank Accession Number: Thy1
Conjugate: Unconjugated Gene Symbol: 24832
Tested Applications: Positive FC detected in Gene ID (NCBI): AB_3672305
Application: Flow Cytometry (FC) RRID: Unconjugated
Dilution: FC : 0.25 ug per 10^6 cells in 100 μl suspension Conjugate: Liquid
Tested Reactivity: Rat Form: Protein A purfication
Host / Isotype: Rabbit / IgG Background Information: CD90 (Thy-1) is a 25 kDa, GPI-linked membrane glycoprotein that belongs to immunoglobulin superfamily (PMID: 6177036; 6153212). Originally described as a brain thymus cross-reactive antigen, it is found in large quantities on mouse and rat thymocytes and central nervous system cells (PMID: 83175). CD90 has been postulated to be involved in cellular recognition, adherence, and T cell activation (PMID: 7683034).

 

 

Reviews

Write Your Own Review
You're reviewing:Anti-Rat CD90 Rabbit Recombinant Antibody proteintech 98162-1-RR
Your Rating
Copyright © 2025 Biogege, Inc. All rights reserved.