TOM20 Recombinant monoclonal antibody proteintech 80501-1-RR
$449.00
In stock
SKU
80501-1-RR
TOMM20, 1D22, KIAA0016, MAS20, MOM19
| Host / Isotype: Rabbit / IgG | Class: Recombinant |
| Reactivity: human, mouse, rat, pig, chicken, zebrafish | Immunogen: CatNo: Ag2378 Product name: Recombinant human TOM20 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-145 aa of BC000882 Sequence: MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 145 aa, 16 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC000882 |
| Conjugate: Unconjugated | Gene Symbol: TOM20 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 9804 |
| Application: Western Blot (WB) | RRID: AB_2918897 |
| Dilution: WB : 1:2000-1:10000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat, Pig, Chicken, Zebrafish | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: TOM20, also named as KIAA0016, belongs to the Tom20 family. It is a central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22, TOM20 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore. TOM20 is characterized as major docking receptors to mediate the recognition by different mechanisms. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
