GBP3 Recombinant monoclonal antibody proteintech 83534-1-RR
$449.00
In stock
SKU
83534-1-RR
230178D8, EC:3.6.5.-, GBP 3, GBP-3, GTP binding protein 3
| Host / Isotype: Rabbit / IgG | Class: Recombinant |
| Reactivity: Human And More (1) | Immunogen: CatNo: Ag33889 Product name: Recombinant human GBP3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 535-595 aa of BC140837 Sequence: RERAQLLEEQEKTLTSKLQEQARVLKERCQGESTQLQNEIQKLQKTLKKKTKRYMSHKLKI* Predict reactive species |
| Applications: WB, FC (Intra), ELISA | Observed Molecular Weight: 62 kDa, 68 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: GBP3 |
| Conjugate: Unconjugated | Gene Symbol: 2635 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): AB_3671159 |
| Application: Western Blot (WB) | RRID: Unconjugated |
| Dilution: WB : 1:500-1:2000 | Conjugate: Liquid |
| Tested Reactivity: Human | Form: Protein A purfication |
| Host / Isotype: Rabbit / IgG | Background Information: Guanylate-binding protein 3 (GBP3) is involved in the proliferation of glioma cells through regulating SQSTM1-ERK1/2 pathway. GBP3 has 2 isoforms, one is 595 amino acids long at 68 kDa and the other is at nearly 62 kDa. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
