Gastrin Monoclonal antibody proteintech 60346-1-Ig
$449.00
In stock
SKU
60346-1-Ig
G14 Gastrin 6, G17 Gastrin 14, G34 Gastrin, G52 Big gastrin, G6, GAS, GAST, gastrin, Gastrin 17, Gastrin 34, Gastrin component I Gastrin 52, Gastrin component II, Gastrin component III
| Host / Isotype: Mouse / IgG2a | Class: Monoclonal |
| Reactivity: human | Immunogen: CatNo: Ag12795 Product name: Recombinant human GAST protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 19-101 aa of BC069724 Sequence: SEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN Predict reactive species |
| Applications: IHC, IF-P, ELISA | Observed Molecular Weight: 101 aa, 11 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: Gastrin |
| Conjugate: Unconjugated | Gene Symbol: 2520 |
| Tested Applications: Positive IHC detected in | Gene ID (NCBI): AB_2881455 |
| Application: Immunohistochemistry (IHC) | RRID: Unconjugated |
| Dilution: IHC : 1:100-1:500 | Conjugate: Liquid |
| Tested Reactivity: Human | Form: Protein A purification |
| Host / Isotype: Mouse / IgG2a | Background Information: Gastrin is a hormone produced primarily by G-cells in the stomach, where it functions to stimulate acid secretion by gastric parietal cells. Gastrin is a promiscuous hormone. Thus, the gastrin gene is expressed in common cancers such as bronchogenic, colorectal, ovarian and pancreatic carcinomas. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
