CD81 Monoclonal antibody proteintech 66866-1-Ig
$449.00
In stock
SKU
66866-1-Ig
1G2C6, 26 kDa cell surface protein TAPA-1, CD81 antigen, CD81 molecule, S5.7
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human And More (3) | Immunogen: CatNo: Ag27298 Product name: Recombinant human CD81 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 114-199 aa of BC002978 Sequence: VNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFS Predict reactive species |
| Applications: WB, IHC, IF-P, ELISA | Observed Molecular Weight: 26 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC002978 |
| Conjugate: Unconjugated | Gene Symbol: CD81 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 975 |
| Application: Western Blot (WB) | RRID: ENSG00000110651 |
| Dilution: WB : 1:1000-1:6000 | Conjugate: AB_2882203 |
| Tested Reactivity: Human | Form: Unconjugated |
| Host / Isotype: Mouse / IgG1 | Background Information: CD81 (also known as TAPA1 or TSPAN28) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Many of these members are expressed on leukocytes and have been implicated in signal transduction, cell-cell interactions, and cellular activation and development. CD81 is involved in signal transduction and cell adhesion in the immune system (PMID: 9597125). CD81 has also been identified as en essential receptor for HCV (hepatitis C virus) (PMID: 21428934). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
