Cystatin C Recombinant monoclonal antibody proteintech 82441-1-RR
$449.00
In stock
SKU
82441-1-RR
CST3, 1I20, Gamma-trace, Cystatin-C, Cystatin-3
| Host / Isotype: Rabbit / IgG | Class: Recombinant |
| Reactivity: Human And More (1) | Immunogen: CatNo: Ag2890 Product name: Recombinant human Cystatin C protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 25-146 aa of BC013083 Sequence: AGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA Predict reactive species |
| Applications: WB, IHC, ELISA | Observed Molecular Weight: 146 aa, 16 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC013083 |
| Conjugate: Unconjugated | Gene Symbol: Cystatin C |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 1471 |
| Application: Western Blot (WB) | RRID: AB_3086479 |
| Dilution: WB : 1:2000-1:15000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: Cystatin C is a 13-kDa inhibitor of cysteine proteinases which is secreted by all cell types and is completely cleared from the organism through glomerular filtration, shown to be an early and sensitive biomarker of renal dysfunction. It is also used as an emerging biomarker in cardiovascular disease. Cystatin C is involved in a variety of inflammatory reactions. The concentration of serum cystatin C has also been shown to be unaltered in certain inflammatory conditions or other disorders of metabolism. The plasma level of serum cystatin C can be expressed as its level of generation from cells and diet and its subsequent elimination through the gut, liver, and kidneys. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
