Neprilysin/CD10 Polyclonal antibody proteintech 18008-1-AP
$449.00
In stock
SKU
18008-1-AP
| Host / Isotype: Rabbit / IgG | Class: Polyclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag12506 Product name: Recombinant human MME,CD10 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC106070 Sequence: MGKSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSSDCIKSGMVARAYNPRGRRIA Predict reactive species |
| Applications: WB, IHC, IF-P, IP, ELISA | Observed Molecular Weight: 80aa,9 kDa; 750aa,85 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC106070 |
| Conjugate: Unconjugated | Gene Symbol: CD10 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 4311 |
| Application: Western Blot (WB) | RRID: AB_2146541 |
| Dilution: WB : 1:500-1:2000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Rabbit / IgG | Background Information: CD10, also known as neprilysin, membrane metallo-endopeptidase (MME), neutral endopeptidase (NEP), or common acute lymphoblastic leukemia antigen (CALLA), is a 100-kDa type II transmembrane glycoprotein belonging to peptidase M13 family (PMID: 7760013; 8102558). Among hematopoietic cells, CD10 is expressed on granulocytes, B cell precursors, mature germinal center B cells, a subset of immature thymocytes (PMID: 13679451). CD10 is also expressed on a variety of nonhematopoietic cell types, including bronchial epithelial cells, cultured fibroblasts, bone marrow stromal cells, renal proximal tubular epithelial cells, breast myoepithelium, biliary canaliculi (PMID: 8102558). CD10 is a cell surface peptidase that cleaves peptide bonds on the amino side of hydrophobic amino acids and inactivates a variety of physiologically active peptides. Loss or decreases in CD10 expression have been reported in a variety of malignancies (PMID: 16054017). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
