IBA1 Recombinant monoclonal antibody proteintech 81728-1-RR
$449.00
In stock
SKU
81728-1-RR
AIF1, 4D5, AIF 1, AIF-1, allograft inflammatory factor 1
| Host / Isotype: Rabbit / IgG | Class: Recombinant |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag1363 Product name: Recombinant human IBA1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-147 aa of BC009474 Sequence: MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP Predict reactive species |
| Applications: WB, IHC, IHC-Autostainer, IF-P, FC (Intra), ELISA | Observed Molecular Weight: 17 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC009474 |
| Conjugate: Unconjugated | Gene Symbol: IBA1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 199 |
| Application: Western Blot (WB) | RRID: ENSG00000204472 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: AB_2935574 |
| Tested Reactivity: Human, Mouse, Rat | Form: Unconjugated |
| Host / Isotype: Rabbit / IgG | Background Information: IBA1 is a 143 amino acid cytoplasmic, inflammation response scaffold protein. It is constitutively expressed in monocytes and macrophages and is known to be involved in macrophage activation. It is a marker of activated macrophage. Expression of IBA1 is up-regulated in activated microglia following facial nerve axotomy, ischemia, and several brain diseases, thereby implicating it in the activated phenotypes of microglia. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
