Glycophorin A/CD235a Monoclonal antibody proteintech 66778-1-Ig
$449.00
In stock
SKU
66778-1-Ig
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human | Immunogen: CatNo: Ag8635 Product name: Recombinant human GYPA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 24-150 aa of BC005319 Sequence: EVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ Predict reactive species |
| Applications: WB, IHC, IF-P, ELISA | Observed Molecular Weight: 150 aa, 16 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC005319 |
| Conjugate: Unconjugated | Gene Symbol: Glycophorin A |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 2993 |
| Application: Western Blot (WB) | RRID: AB_2882124 |
| Dilution: WB : 1:2000-1:6000 | Conjugate: Unconjugated |
| Tested Reactivity: Human | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: Glycophorin A (GYPA) is the major transmembrane sialoglycoprotein in erythrocytes. It is a dimeric type I transmembrane protein carrying 15 closely clustered O-linked tetrasaccharides capped with sialic acid/N-acetylneuraminic acid (Neu5Ac). This 36 kDa protein represents the major sialoglycoprotein of the red blood cell membrane displaying about one million copies per cell. (PMID: 9490702) |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
