AQP1 Monoclonal antibody proteintech 66805-1-Ig
$449.00
In stock
SKU
66805-1-Ig
AQP 1, AQP CHIP, AQP1, Aquaporin 1, Aquaporin CHIP, CHIP28, CO, Urine water channel
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human, Pig And More (2) | Immunogen: CatNo: Ag14093 Product name: Recombinant human AQP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 220-269 aa of BC022486 Sequence: GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK Predict reactive species |
| Applications: WB, IHC, IF-P, ELISA | Observed Molecular Weight: 269 aa, 29 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC022486 |
| Conjugate: Unconjugated | Gene Symbol: AQP1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 358 |
| Application: Western Blot (WB) | RRID: AB_2882148 |
| Dilution: WB : 1:5000-1:20000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Pig | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: AQP1 is a member of aquaporins (AQPs) that are small membrane-spanning proteins facilitating water transport. AQP1 is expressed in most tissues in the mammalian body. Alterations of AQP1 expression have been linked to variety of diseases, including cancer. The predicted molecular weight of AQP1 is around 28 kDa, while highly glycosylated form can also be observed around 40-45 kDa. (1530176) |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
