ESRRB Monoclonal antibody proteintech 66818-1-Ig
$449.00
In stock
SKU
66818-1-Ig
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, mouse, rat | Immunogen: CatNo: Ag18626 Product name: Recombinant human ESRRB protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-91 aa of BC131517 Sequence: MSSDDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGLALGTHANGLDSPPMFAGAGLGGTPCRKSYEDCASGIMEDSAIKC Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 508 aa, 56 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC131517 |
| Conjugate: Unconjugated | Gene Symbol: ESRRB |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 2103 |
| Application: Western Blot (WB) | RRID: AB_2882161 |
| Dilution: WB : 1:1000-1:4000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: Estrogen related receptor beta (ESRRB), a NR3 Steroid Receptor, has been shown to affect early placental development. Also it can act as a repressor of transcriptional activity mediated by the glucocorticoid receptor (GR). It binds as a monomer to the extended half-site TNAAGTGCA and as a homodimer to the estrogen response element (ERE), palindromic thyroid hormone response element (TRE(pal)), and SF-1 response element, but not to the glucocorticoid response element (GRE). Estrogen related receptor beta mutations lead to abnormal development of the chorion and defective diploid trophoblast proliferation, and are lethal during midgestation. Expression has been documented in mice in the extra embryonic ectoderm that gives rise to the chorion. ESTs have been isolated from normal human eye, lung, and testis libraries. The ligand for the receptor is PPARgamma coactivator 1 (PGC-1) beta. ESRRB exists various isoforms and molecular weight of each isoform is 48 kDa,55 kDa and 56 kDa. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
