Caveolin-1 Monoclonal antibody proteintech 66067-1-Ig
$449.00
In stock
SKU
66067-1-Ig
CAV1, Caveolin 1, 6C2B2, BSCL3, CAV
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human, Mouse, Rat, Pig And More (4) | Immunogen: CatNo: Ag8049 Product name: Recombinant human Caveolin-1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 11-179 aa of BC006432 Sequence: GHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI Predict reactive species |
| Applications: WB, IHC, IF/ICC, IF-P, IP, ELISA | Observed Molecular Weight: 22 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC006432 |
| Conjugate: Unconjugated | Gene Symbol: CAV1 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 857 |
| Application: Western Blot (WB) | RRID: AB_11043343 |
| Dilution: WB : 1:2000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat, Pig | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: Caveolin-1 (CAV1), a multifunctional protein, is the main constituent molecule of caveolae and represents a scaffolding molecule for several signaling molecules including epidermal growth factor receptor (PMID: 19641024). Several studies have implicated that a reduced expression of CAV1 was found in cancers including head and neck carcinoma (PMID: 19002186). However, other studies recognize CAV1 as a tumor promoter because CAV1 is overexpressed in various kinds of cancers, especially in oral cancer (PMID: 20558341). Recent study also show that CAV1 is involved in gastric Cancer (PMID: 25339030). |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
