EIF5A2 Monoclonal antibody proteintech 67907-1-Ig
$449.00
In stock
SKU
67907-1-Ig
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: Human, Rat And More (1) | Immunogen: CatNo: Ag10852 Product name: Recombinant human EIF5A2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-153 aa of BC036072 Sequence: MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK Predict reactive species |
| Applications: WB, IHC, IF/ICC, ELISA | Observed Molecular Weight: 153 aa, 17 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC036072 |
| Conjugate: Unconjugated | Gene Symbol: EIF5A2 |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 56648 |
| Application: Western Blot (WB) | RRID: AB_2918663 |
| Dilution: WB : 1:5000-1:50000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Rat | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: Eukaryotic translation initiation factor 5A (EIF5A), a conserved lysine to hypusine, is strictly indispensable for the survival of eukaryotic cells. There are two EIF5A isoforms in humans: EIF5A1 and EIF5A2. EIF5A2 has been reported to be overexpressed in gallbladder cancer, upper urinary tract urothelial carcinoma, gastric cancer, prostate cancer, nasopharyngeal carcinoma, and cervical cancer. EIF5A2 upregulation in cancer tissues is associated with poor prognosis in these patients. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
