Destrin Monoclonal antibody proteintech 67657-1-Ig
$449.00
In stock
SKU
67657-1-Ig
| Host / Isotype: Mouse / IgG1 | Class: Monoclonal |
| Reactivity: human, mouse, rat, pig | Immunogen: CatNo: Ag1402 Product name: Recombinant human DSTN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-165 aa of BC009477 Sequence: MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGPEDLNRACIAEKLGGSLIVAFEGCPV Predict reactive species |
| Applications: WB, ELISA | Observed Molecular Weight: 19 kDa |
| Formulation: PBS, Azide, Glycerol | GenBank Accession Number: BC009477 |
| Conjugate: Unconjugated | Gene Symbol: Destrin |
| Tested Applications: Positive WB detected in | Gene ID (NCBI): 11034 |
| Application: Western Blot (WB) | RRID: AB_2918496 |
| Dilution: WB : 1:3000-1:20000 | Conjugate: Unconjugated |
| Tested Reactivity: Human, Mouse, Rat, Pig | Form: Liquid |
| Host / Isotype: Mouse / IgG1 | Background Information: Destrin (also known as actin depolymerization factor, ADF) is an actin-binding protein contributing to cytoskeletal dynamics by promoting rapid actin filament disassembly. By regulating actin cytoskeletal reorganization it plays an important role in the formation of filopodia, which further promotes tumor cell invasion and metastasis. Destrin has been reported to be overexpressed in primary colon cancer. |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
